X-ray crystallographic studies of recombinant inorganic pyrophosphatase from escherichia coli
PDB DOI: 10.2210/pdb1igp/pdb
Classification: ACID ANHYDRIDE HYDROLASE Organism(s): Escherichia Coli
Deposited: 1994-08-01 Deposition Author(s): Avaeva, S.M. , Harutyunyan, E.H. , Oganessyan, V.Yu.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
X-ray crystallographic studies of recombinant inorganic pyrophosphatase from escherichia coli
Avaeva, S.M. , Harutyunyan, E.H. , Oganessyan, V.Yu.
Primary Citation of Related Structures: 1IGP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INORGANIC PYROPHOSPHATASE | A | 175 | Escherichia Coli | SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-08-01 Deposition Author(s): Avaeva, S.M. , Harutyunyan, E.H. , Oganessyan, V.Yu.