Solution structure of the methyl-cpg-binding domain of human mbd1 in complex with methylated dna
PDB DOI: 10.2210/pdb1ig4/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2001-04-17 Deposition Author(s): Fujita, N. , Ikegami, T. , Jee, J.-G. , Nakao, M. , Ohki, I. , Shimotake, N. , Shirakawa, M.
Solution structure of the methyl-cpg-binding domain of human mbd1 in complex with methylated dna
Fujita, N. , Ikegami, T. , Jee, J.-G. , Nakao, M. , Ohki, I. , Shimotake, N. , Shirakawa, M.
Primary Citation of Related Structures: 1IG4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methyl-CpG Binding Protein | A | 75 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK |
Method: SOLUTION NMR
Deposited Date: 2001-04-17 Deposition Author(s): Fujita, N. , Ikegami, T. , Jee, J.-G. , Nakao, M. , Ohki, I. , Shimotake, N. , Shirakawa, M.