Crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)
PDB DOI: 10.2210/pdb1i27/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2001-02-07 Deposition Author(s): Burley, S.K. , De Angelis, J. , Kamada, K. , Roeder, R.G.
Method: X-RAY DIFFRACTION Resolution: 1.02 Å
Crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)
Burley, S.K. , De Angelis, J. , Kamada, K. , Roeder, R.G.
Primary Citation of Related Structures: 1I27
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TRANSCRIPTION FACTOR IIF | A | 73 | Homo Sapiens | GPLGSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-02-07 Deposition Author(s): Burley, S.K. , De Angelis, J. , Kamada, K. , Roeder, R.G.