Solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
PDB DOI: 10.2210/pdb1i26/pdb
Classification: TOXIN Organism(s): Rickettsia Prowazekii (Strain Madrid E)
Deposited: 2001-02-06 Deposition Author(s): Bernard, C. , Corzo, G. , Darbon, H. , Mosbah, A. , Nakajima, T.
Solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
Bernard, C. , Corzo, G. , Darbon, H. , Mosbah, A. , Nakajima, T.
Primary Citation of Related Structures: 1I26
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PTU-1 | A | 34 | Rickettsia Prowazekii (Strain Madrid E) | AEKDCIAPGAPCFGTDKPCCNPRAWCSSYANKCL |
Method: SOLUTION NMR
Deposited Date: 2001-02-06 Deposition Author(s): Bernard, C. , Corzo, G. , Darbon, H. , Mosbah, A. , Nakajima, T.