Origin of the ph-dependent spectroscopic properties of pentacoordinate metmyoglobin variants
PDB DOI: 10.2210/pdb1hsy/pdb
Classification: OXYGEN TRANSPORT Organism(s): Equus Caballus
Deposited: 1994-12-12 Deposition Author(s): Brayer, G.D. , Maurus, R.
Origin of the ph-dependent spectroscopic properties of pentacoordinate metmyoglobin variants
Primary Citation of Related Structures: 1HSY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MYOGLOBIN | A | 153 | Equus Caballus | GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKTGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-12-12 Deposition Author(s): Brayer, G.D. , Maurus, R.