The 3d structure of the human sry-dna complex solved by multi-dimensional heteronuclear-edited and-filtered nmr
PDB DOI: 10.2210/pdb1hrz/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 1995-05-09 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.
Method: SOLUTION NMR Resolution: N.A.
The 3d structure of the human sry-dna complex solved by multi-dimensional heteronuclear-edited and-filtered nmr
Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.
Primary Citation of Related Structures: 1HRZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HUMAN SRY | A | 76 | Homo Sapiens , Synthetic Construct | VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRP |
Method: SOLUTION NMR
Deposited Date: 1995-05-09 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.