The 3d structure of the human sry-dna complex solved by multid-dimensional heteronuclear-edited and-filtered nmr
PDB DOI: 10.2210/pdb1hry/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1995-05-09 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.
Method: SOLUTION NMR Resolution: N.A.
The 3d structure of the human sry-dna complex solved by multid-dimensional heteronuclear-edited and-filtered nmr
Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.
Primary Citation of Related Structures: 1HRY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
HUMAN SRY | A | 76 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRP |
Method: SOLUTION NMR
Deposited Date: 1995-05-09 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Huth, J.R. , Werner, M.H.