The three dimensional structure of the reduced high potential iron-sulfur protein from chromatium vinosum through nmr
PDB DOI: 10.2210/pdb1hrr/pdb
Classification: ELECTRON TRANSFER (IRON-SULFUR) Organism(s): Allochromatium Vinosum
Deposited: 1995-01-17 Deposition Author(s): Banci, L. , Bertini, I. , Dikiy, A. , Kastrau, D.H.W. , Luchinat, C. , Sompornpisut, P.
The three dimensional structure of the reduced high potential iron-sulfur protein from chromatium vinosum through nmr
Banci, L. , Bertini, I. , Dikiy, A. , Kastrau, D.H.W. , Luchinat, C. , Sompornpisut, P.
Primary Citation of Related Structures: 1HRR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| REDUCED HIGH POTENTIAL IRON SULFUR PROTEIN | A | 85 | Allochromatium Vinosum | SAPANAVAADDATAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQADAAGATDEWKGCQLFPGKLINVNGWCASWTLKAG |
Method: SOLUTION NMR
Deposited Date: 1995-01-17 Deposition Author(s): Banci, L. , Bertini, I. , Dikiy, A. , Kastrau, D.H.W. , Luchinat, C. , Sompornpisut, P.