Structure of the hmg box motif in the b-domain of hmg1
PDB DOI: 10.2210/pdb1hmf/pdb
Classification: DNA-BINDING Organism(s): Rattus Norvegicus
Deposited: 1994-03-07 Deposition Author(s): Hill, C.S. , Kraulis, P.J. , Laue, E.D. , Raine, A.R.C. , Thomas, J.O. , Weir, H.M.
Structure of the hmg box motif in the b-domain of hmg1
Hill, C.S. , Kraulis, P.J. , Laue, E.D. , Raine, A.R.C. , Thomas, J.O. , Weir, H.M.
Primary Citation of Related Structures: 1HMF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIGH MOBILITY GROUP PROTEIN FRAGMENT-B | A | 77 | Rattus Norvegicus | FKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK |
Method: SOLUTION NMR
Deposited Date: 1994-03-07 Deposition Author(s): Hill, C.S. , Kraulis, P.J. , Laue, E.D. , Raine, A.R.C. , Thomas, J.O. , Weir, H.M.