1HEF
The crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
PDB DOI: 10.2210/pdb1hef/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1992-09-21 Deposition Author(s): Culp, J.S. , Debouck, C. , Minnich, M.D. , Murthy, K. , Winborne, E.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
The crystal structures at 2.2 angstroms resolution of hydroxyethylene-based inhibitors bound to human immunodeficiency virus type 1 protease show that the inhibitors are present in two distinct orientations
Culp, J.S. , Debouck, C. , Minnich, M.D. , Murthy, K. , Winborne, E.L.
Primary Citation of Related Structures: 1HEF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 PROTEASE | E | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEENSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| SKF 108738 PEPTIDE INHIBITOR | I | 5 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AAXVX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 1992-09-21 Deposition Author(s): Culp, J.S. , Debouck, C. , Minnich, M.D. , Murthy, K. , Winborne, E.L.