1H9F
Lem domain of human inner nuclear membrane protein lap2
PDB DOI: 10.2210/pdb1h9f/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2001-03-09 Deposition Author(s): Callebaut, I. , Courchay, K. , Gilquin, B. , Laguri, C. , Romi-Lebrun, R. , Wolff, N. , Worman, H.J. , Zinn-Justin, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Lem domain of human inner nuclear membrane protein lap2
Callebaut, I. , Courchay, K. , Gilquin, B. , Laguri, C. , Romi-Lebrun, R. , Wolff, N. , Worman, H.J. , Zinn-Justin, S.
Primary Citation of Related Structures: 1H9F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lamina-associated polypeptide 2, isoform alpha | A | 57 | N.A. | RQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2001-03-09 Deposition Author(s): Callebaut, I. , Courchay, K. , Gilquin, B. , Laguri, C. , Romi-Lebrun, R. , Wolff, N. , Worman, H.J. , Zinn-Justin, S.