The helix-hinge-helix structural motif in human apolipoprotein a-i determined by nmr spectroscopy, 1 structure
PDB DOI: 10.2210/pdb1gw4/pdb
Classification: HIGH DENSITY LIPOPROTEINS Organism(s): Homo Sapiens
Deposited: 1997-06-04 Deposition Author(s): Cushley, R.J. , Sparrow, J.T. , Wang, G.
Method: SOLUTION NMR Resolution: N.A.
The helix-hinge-helix structural motif in human apolipoprotein a-i determined by nmr spectroscopy, 1 structure
Cushley, R.J. , Sparrow, J.T. , Wang, G.
Primary Citation of Related Structures: 1GW4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| APOA-I | A | 46 | Homo Sapiens | SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA |
Method: SOLUTION NMR
Deposited Date: 1997-06-04 Deposition Author(s): Cushley, R.J. , Sparrow, J.T. , Wang, G.