1GUW
Structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
PDB DOI: 10.2210/pdb1guw/pdb
Classification: CHROMATIN-BINDING Organism(s): Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-02-01 Deposition Author(s): Bannister, A. , Callaghan, J.M. , Kouzarides, T. , Laue, E.D. , Mott, H.R. , Murzin, A.G. , Murzina, N.V. , Nielsen, P.R. , Nietlispach, D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
Bannister, A. , Callaghan, J.M. , Kouzarides, T. , Laue, E.D. , Mott, H.R. , Murzin, A.G. , Murzina, N.V. , Nielsen, P.R. , Nietlispach, D.
Primary Citation of Related Structures: 1GUW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CHROMOBOX PROTEIN HOMOLOG 1 | A | 73 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS |
| HISTONE H3.1 | B | 18 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGGKAPGG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-02-01 Deposition Author(s): Bannister, A. , Callaghan, J.M. , Kouzarides, T. , Laue, E.D. , Mott, H.R. , Murzin, A.G. , Murzina, N.V. , Nielsen, P.R. , Nietlispach, D.