Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
PDB DOI: 10.2210/pdb1gjd/pdb
Classification: BLOOD CLOTTING, hydrolase Organism(s): Homo Sapiens
Deposited: 2001-05-03 Deposition Author(s): Allen, D. , Breitenbucher, J.G. , Hui, H. , Katz, B.A. , Luong, C. , Mackman, R.L. , Martelli, A. , Mcgee, D. , Spencer, J.R. , Sprengeler, P.A. , Verner, E.
Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Allen, D. , Breitenbucher, J.G. , Hui, H. , Katz, B.A. , Luong, C. , Mackman, R.L. , Martelli, A. , Mcgee, D. , Spencer, J.R. , Sprengeler, P.A. , Verner, E.
Primary Citation of Related Structures: 1GJD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UROKINASE-TYPE PLASMINOGEN ACTIVATOR | A | 23 | Homo Sapiens | KPSSPPEELKFQCGQKTLRPRFK |
| UROKINASE-TYPE PLASMINOGEN ACTIVATOR | B | 253 | Homo Sapiens | IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-05-03 Deposition Author(s): Allen, D. , Breitenbucher, J.G. , Hui, H. , Katz, B.A. , Luong, C. , Mackman, R.L. , Martelli, A. , Mcgee, D. , Spencer, J.R. , Sprengeler, P.A. , Verner, E.