Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
PDB DOI: 10.2210/pdb1gbq/pdb
Classification: COMPLEX (SIGNAL TRANSDUCTION/PEPTIDE) Organism(s): Mus Musculus
Deposited: 1996-12-23 Deposition Author(s): Friedrichs, M.S. , Goldfarb, V. , Lee, V. , Mapelli, C. , Meyers, C.A. , Mueller, L. , Wittekind, M.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Friedrichs, M.S. , Goldfarb, V. , Lee, V. , Mapelli, C. , Meyers, C.A. , Mueller, L. , Wittekind, M.
Primary Citation of Related Structures: 1GBQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GRB2 | A | 74 | Mus Musculus | GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD |
| SOS-1 | B | 12 | Mus Musculus | XVPPPVPPRRRX |
Method: SOLUTION NMR
Deposited Date: 1996-12-23 Deposition Author(s): Friedrichs, M.S. , Goldfarb, V. , Lee, V. , Mapelli, C. , Meyers, C.A. , Mueller, L. , Wittekind, M.