Nmr structure of the fifth domain of human beta2-glycoprotein i
PDB DOI: 10.2210/pdb1g4g/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2000-10-27 Deposition Author(s): Goto, Y. , Hagihara, Y. , Hoshino, M. , Kato, H. , Nishii, I. , Yamazaki, T.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the fifth domain of human beta2-glycoprotein i
Goto, Y. , Hagihara, Y. , Hoshino, M. , Kato, H. , Nishii, I. , Yamazaki, T.
Primary Citation of Related Structures: 1G4G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BETA2-GLYCOPROTEIN I | A | 86 | Homo Sapiens | TKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC |
Method: SOLUTION NMR
Deposited Date: 2000-10-27 Deposition Author(s): Goto, Y. , Hagihara, Y. , Hoshino, M. , Kato, H. , Nishii, I. , Yamazaki, T.