Nmr structure of n-terminal domain of htlv-i ca1-134
PDB DOI: 10.2210/pdb1g03/pdb
Classification: VIRAL PROTEIN Organism(s): Human T-Lymphotropic Virus 1
Deposited: 2000-10-05 Deposition Author(s): Bouamr, F. , Carter, C. , Cornilescu, C.C. , Tjandra, N. , Yao, X.
Nmr structure of n-terminal domain of htlv-i ca1-134
Bouamr, F. , Carter, C. , Cornilescu, C.C. , Tjandra, N. , Yao, X.
Primary Citation of Related Structures: 1G03
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HTLV-I CAPSID PROTEIN | A | 134 | Human T-Lymphotropic Virus 1 | PVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITSYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWA |
Method: SOLUTION NMR
Deposited Date: 2000-10-05 Deposition Author(s): Bouamr, F. , Carter, C. , Cornilescu, C.C. , Tjandra, N. , Yao, X.