Solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
PDB DOI: 10.2210/pdb1fvq/pdb
Classification: HYDROLASE Organism(s): Saccharomyces Cerevisiae
Deposited: 2000-09-20 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi Baffoni, S. , Huffman, D.L. , O'Halloran, T.V.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
Banci, L. , Bertini, I. , Ciofi Baffoni, S. , Huffman, D.L. , O'Halloran, T.V.
Primary Citation of Related Structures: 1FVQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| COPPER-TRANSPORTING ATPASE | A | 72 | Saccharomyces Cerevisiae | AREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDS |
Method: SOLUTION NMR
Deposited Date: 2000-09-20 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi Baffoni, S. , Huffman, D.L. , O'Halloran, T.V.