Hen egg white lysozyme mutant with alanine substituted for glycine
PDB DOI: 10.2210/pdb1flq/pdb
Classification: HYDROLASE Organism(s): Gallus Gallus
Deposited: 2000-08-15 Deposition Author(s): Imoto, T. , Masumoto, K. , Motoshima, H. , Ueda, T.
Hen egg white lysozyme mutant with alanine substituted for glycine
Imoto, T. , Masumoto, K. , Motoshima, H. , Ueda, T.
Primary Citation of Related Structures: 1FLQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LYSOZYME | A | 129 | Gallus Gallus | KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKATDVQAWIRGCRL |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-08-15 Deposition Author(s): Imoto, T. , Masumoto, K. , Motoshima, H. , Ueda, T.