1F95
Solution structure of dynein light chain 8 (dlc8) and bim peptide complex
PDB DOI: 10.2210/pdb1f95/pdb
Classification: CONTRACTILE PROTEIN/peptide Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-07-07 Deposition Author(s): Fan, J.-S. , Li, M. , Tochio, H. , Zhang, M. , Zhang, Q.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of dynein light chain 8 (dlc8) and bim peptide complex
Fan, J.-S. , Li, M. , Tochio, H. , Zhang, M. , Zhang, Q.
Primary Citation of Related Structures: 1F95
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DYNEIN | A | 89 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| DYNEIN | B | 89 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| BCL2-LIKE 11 (APOPTOSIS FACILITATOR) | C | 9 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSCDKSTQT |
| BCL2-LIKE 11 (APOPTOSIS FACILITATOR) | D | 9 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSCDKSTQT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2000-07-07 Deposition Author(s): Fan, J.-S. , Li, M. , Tochio, H. , Zhang, M. , Zhang, Q.