Nmr structure of the sixth ligand-binding module of the ldl receptor
PDB DOI: 10.2210/pdb1f8z/pdb
Classification: LIPID BINDING PROTEIN Organism(s): N.A.
Deposited: 2000-07-05 Deposition Author(s): Brereton, I.M. , Clayton, D.J. , Kroon, P.A. , Smith, R.
Nmr structure of the sixth ligand-binding module of the ldl receptor
Brereton, I.M. , Clayton, D.J. , Kroon, P.A. , Smith, R.
Primary Citation of Related Structures: 1F8Z
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LOW-DENSITY LIPOPROTEIN RECEPTOR | A | 39 | N.A. | ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVN |
Method: SOLUTION NMR
Deposited Date: 2000-07-05 Deposition Author(s): Brereton, I.M. , Clayton, D.J. , Kroon, P.A. , Smith, R.