Nmr structure of a concatemer of the first and second ligand-binding modules of the human ldl receptor
PDB DOI: 10.2210/pdb1f5y/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2000-06-18 Deposition Author(s): Atkins, A.R. , Brereton, I.M. , Kroon, P.A. , Kurniawan, N.D. , Smith, R.
Nmr structure of a concatemer of the first and second ligand-binding modules of the human ldl receptor
Atkins, A.R. , Brereton, I.M. , Kroon, P.A. , Kurniawan, N.D. , Smith, R.
Primary Citation of Related Structures: 1F5Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LOW-DENSITY LIPOPROTEIN RECEPTOR | A | 85 | Homo Sapiens | GSAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC |
Method: SOLUTION NMR
Deposited Date: 2000-06-18 Deposition Author(s): Atkins, A.R. , Brereton, I.M. , Kroon, P.A. , Kurniawan, N.D. , Smith, R.