Solution structure of the apo n-terminal domain of yeast calmodulin
PDB DOI: 10.2210/pdb1f54/pdb
Classification: TRANSPORT PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2000-06-13 Deposition Author(s): Hikichi, K. , Ishida, H. , Kumaki, Y. , Nakashima, K. , Nakata, M. , Takahashi, K. , Yazawa, M.
Solution structure of the apo n-terminal domain of yeast calmodulin
Hikichi, K. , Ishida, H. , Kumaki, Y. , Nakashima, K. , Nakata, M. , Takahashi, K. , Yazawa, M.
Primary Citation of Related Structures: 1F54
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CALMODULIN | A | 77 | Saccharomyces Cerevisiae | SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK |
Method: SOLUTION NMR
Deposited Date: 2000-06-13 Deposition Author(s): Hikichi, K. , Ishida, H. , Kumaki, Y. , Nakashima, K. , Nakata, M. , Takahashi, K. , Yazawa, M.