Structural studies of a baboon (papio sp.) plasma protein inhibitor of cholesteryl ester transferase.
PDB DOI: 10.2210/pdb1eze/pdb
Classification: TRANSFERASE INHIBITOR Organism(s): N.A.
Deposited: 2000-05-10 Deposition Author(s): Buchko, G.W. , Cushley, R.J. , Kanda, P. , Kennedy, M.A. , Rozek, A.
Structural studies of a baboon (papio sp.) plasma protein inhibitor of cholesteryl ester transferase.
Buchko, G.W. , Cushley, R.J. , Kanda, P. , Kennedy, M.A. , Rozek, A.
Primary Citation of Related Structures: 1EZE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CHOLESTERYL ESTER TRANSFERASE INHIBITOR PROTEIN | A | 38 | N.A. | APDVSSALDKLKEFGNTLEDKAWEVINRIKQSEFPAKT |
Method: SOLUTION NMR
Deposited Date: 2000-05-10 Deposition Author(s): Buchko, G.W. , Cushley, R.J. , Kanda, P. , Kennedy, M.A. , Rozek, A.