Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
PDB DOI: 10.2210/pdb1enc/pdb
Classification: HYDROLASE(PHOSPHORIC DIESTER) Organism(s): Staphylococcus Aureus
Deposited: 1994-02-14 Deposition Author(s): Gittis, A. , Lattman, E.E. , Libson, A.
Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Gittis, A. , Lattman, E.E. , Libson, A.
Primary Citation of Related Structures: 1ENC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| STAPHYLOCOCCAL NUCLEASE | A | 149 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-02-14 Deposition Author(s): Gittis, A. , Lattman, E.E. , Libson, A.