The structure of the rack1 interaction sites located within the unique n-terminal region of the camp-specific phosphodiesterase, pde4d5.
PDB DOI: 10.2210/pdb1e9k/pdb
Classification: HYDROLASE Organism(s): N.A.
Deposited: 2000-10-20 Deposition Author(s): Bolger, G.B. , Houslay, M.D. , Hyde, E.I. , Mccahill, A. , Smith, K.J. , Steele, M.R.
Method: SOLUTION NMR Resolution: N.A.
The structure of the rack1 interaction sites located within the unique n-terminal region of the camp-specific phosphodiesterase, pde4d5.
Bolger, G.B. , Houslay, M.D. , Hyde, E.I. , Mccahill, A. , Smith, K.J. , Steele, M.R.
Primary Citation of Related Structures: 1E9K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-specific 3',5'-cyclic phosphodiesterase 4D | A | 38 | N.A. | VPEVDNPHCPNPWLNEDLVKSLRENLLQHEKSKTARKS |
Method: SOLUTION NMR
Deposited Date: 2000-10-20 Deposition Author(s): Bolger, G.B. , Houslay, M.D. , Hyde, E.I. , Mccahill, A. , Smith, K.J. , Steele, M.R.