Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
PDB DOI: 10.2210/pdb1e7k/pdb
Classification: RNA BINDING PROTEIN Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-08-29 Deposition Author(s): Ficner, R. , Harthmuth, K. , Luhrmann, R. , Nottrott, S. , Vidovic, I.
Crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Ficner, R. , Harthmuth, K. , Luhrmann, R. , Nottrott, S. , Vidovic, I.
Primary Citation of Related Structures: 1E7K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
15.5 KD RNA BINDING PROTEIN | A | 128 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
15.5 KD RNA BINDING PROTEIN | B | 128 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-08-29 Deposition Author(s): Ficner, R. , Harthmuth, K. , Luhrmann, R. , Nottrott, S. , Vidovic, I.