Two-component signal transduction system d12a mutant of chey
PDB DOI: 10.2210/pdb1e6k/pdb
Classification: SIGNALING PROTEIN Organism(s): Escherichia Coli
Deposited: 2000-08-18 Deposition Author(s): Coll, M. , Cronet, P. , Lacroix, E. , Lopez-Hernandez, E. , Parraga, A. , Serrano, L. , Sola, M.
Two-component signal transduction system d12a mutant of chey
Coll, M. , Cronet, P. , Lacroix, E. , Lopez-Hernandez, E. , Parraga, A. , Serrano, L. , Sola, M.
Primary Citation of Related Structures: 1E6K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chemotaxis protein CheY | A | 130 | Escherichia Coli | MRSDKELKFLVVADFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-08-18 Deposition Author(s): Coll, M. , Cronet, P. , Lacroix, E. , Lopez-Hernandez, E. , Parraga, A. , Serrano, L. , Sola, M.