Crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution
PDB DOI: 10.2210/pdb1dxg/pdb
Classification: NON-HEME IRON PROTEIN Organism(s): Desulfovibrio Gigas
Deposited: 1997-07-04 Deposition Author(s): Archer, M. , Huber, R. , Romao, M.J.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution
Archer, M. , Huber, R. , Romao, M.J.
Primary Citation of Related Structures: 1DXG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DESULFOREDOXIN | A | 36 | Desulfovibrio Gigas | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
| DESULFOREDOXIN | B | 36 | Desulfovibrio Gigas | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 1997-07-04 Deposition Author(s): Archer, M. , Huber, R. , Romao, M.J.