1DT7
Solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
PDB DOI: 10.2210/pdb1dt7/pdb
Classification: SIGNALING PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-01-11 Deposition Author(s): Baldisseri, D.M. , Rustandi, R.R. , Weber, D.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Baldisseri, D.M. , Rustandi, R.R. , Weber, D.J.
Primary Citation of Related Structures: 1DT7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| S100 CALCIUM-BINDING PROTEIN | A | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| S100 CALCIUM-BINDING PROTEIN | B | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| CELLULAR TUMOR ANTIGEN P53 | X | 22 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SHLKSKKGQSTSRHKKLMFKTE |
| CELLULAR TUMOR ANTIGEN P53 | Y | 22 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SHLKSKKGQSTSRHKKLMFKTE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2000-01-11 Deposition Author(s): Baldisseri, D.M. , Rustandi, R.R. , Weber, D.J.