Crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb1ddk/pdb
Classification: HYDROLASE Organism(s): Pseudomonas Aeruginosa
Deposited: 1999-11-10 Deposition Author(s): Abdel-Meguid, S.S. , Bateson, J.H. , Cheever, C.A. , Clarke, B.P. , Concha, N.O. , Frere, J.M. , Galleni, M. , Janson, C.A. , Lewis, C. , Payne, D.J. , Pearson, S. , Rowling, P.
Crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
Abdel-Meguid, S.S. , Bateson, J.H. , Cheever, C.A. , Clarke, B.P. , Concha, N.O. , Frere, J.M. , Galleni, M. , Janson, C.A. , Lewis, C. , Payne, D.J. , Pearson, S. , Rowling, P.
Primary Citation of Related Structures: 1DDK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| IMP-1 METALLO BETA-LACTAMASE | A | 220 | Pseudomonas Aeruginosa | ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-11-10 Deposition Author(s): Abdel-Meguid, S.S. , Bateson, J.H. , Cheever, C.A. , Clarke, B.P. , Concha, N.O. , Frere, J.M. , Galleni, M. , Janson, C.A. , Lewis, C. , Payne, D.J. , Pearson, S. , Rowling, P.