Crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
PDB DOI: 10.2210/pdb1dcq/pdb
Classification: METAL BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 1999-11-05 Deposition Author(s): Andreev, J. , Hubbard, S.R. , Mandiyan, V. , Schlessinger, J.
Crystal structure of the arf-gap domain and ankyrin repeats of papbeta.
Andreev, J. , Hubbard, S.R. , Mandiyan, V. , Schlessinger, J.
Primary Citation of Related Structures: 1DCQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PYK2-ASSOCIATED PROTEIN BETA | A | 278 | Mus Musculus | MELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLL |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-11-05 Deposition Author(s): Andreev, J. , Hubbard, S.R. , Mandiyan, V. , Schlessinger, J.