Crystal structure of a binary complex of protein kinase ck2 (alpha-subunit) and mg-amppnp
PDB DOI: 10.2210/pdb1daw/pdb
Classification: TRANSFERASE Organism(s): Zea Mays
Deposited: 1999-11-01 Deposition Author(s): Guerra, B. , Issinger, O.G. , Niefind, K. , Puetter, M. , Schomburg, D.
Crystal structure of a binary complex of protein kinase ck2 (alpha-subunit) and mg-amppnp
Guerra, B. , Issinger, O.G. , Niefind, K. , Puetter, M. , Schomburg, D.
Primary Citation of Related Structures: 1DAW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN KINASE CK2 | A | 327 | Zea Mays | SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-11-01 Deposition Author(s): Guerra, B. , Issinger, O.G. , Niefind, K. , Puetter, M. , Schomburg, D.