1D5G
Solution structure of the pdz2 domain from human phosphatase hptp1e complexed with a peptide
PDB DOI: 10.2210/pdb1d5g/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1999-10-07 Deposition Author(s): Ekiel, I. , Gehring, K. , Kozlov, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the pdz2 domain from human phosphatase hptp1e complexed with a peptide
Ekiel, I. , Gehring, K. , Kozlov, G.
Primary Citation of Related Structures: 1D5G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HUMAN PHOSPHATASE HPTP1E | A | 96 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT |
| PEPTIDE FADSEADENEQVSAV | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | FADSEADENEQVSAV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 1999-10-07 Deposition Author(s): Ekiel, I. , Gehring, K. , Kozlov, G.