Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
PDB DOI: 10.2210/pdb1cyu/pdb
Classification: PROTEINASE INHIBITOR (CYSTEINE) Organism(s): Homo Sapiens
Deposited: 1995-08-24 Deposition Author(s): Kainosho, M. , Samejima, T. , Tate, N.U. , Tate, S. , Ushioda, T.
Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Kainosho, M. , Samejima, T. , Tate, N.U. , Tate, S. , Ushioda, T.
Primary Citation of Related Structures: 1CYU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CYSTATIN A | A | 98 | Homo Sapiens | MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
Method: SOLUTION NMR
Deposited Date: 1995-08-24 Deposition Author(s): Kainosho, M. , Samejima, T. , Tate, N.U. , Tate, S. , Ushioda, T.