Nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
PDB DOI: 10.2210/pdb1cto/pdb
Classification: BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 1996-09-25 Deposition Author(s): Anaguchi, H. , Naito, S. , Ohkubo, T. , Ota, Y. , Yamasaki, K.
Nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
Anaguchi, H. , Naito, S. , Ohkubo, T. , Ota, Y. , Yamasaki, K.
Primary Citation of Related Structures: 1CTO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR | A | 109 | Mus Musculus | GSSLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMK |
Method: SOLUTION NMR
Deposited Date: 1996-09-25 Deposition Author(s): Anaguchi, H. , Naito, S. , Ohkubo, T. , Ota, Y. , Yamasaki, K.