Solution structure of the n-terminal domain of ribosomal protein l9
PDB DOI: 10.2210/pdb1cqu/pdb
Classification: RIBOSOME Organism(s): Geobacillus Stearothermophilus
Deposited: 1999-08-11 Deposition Author(s): Hoffman, D. , Hua, Y. , Kuhlman, B. , Raleigh, D.P.
Solution structure of the n-terminal domain of ribosomal protein l9
Hoffman, D. , Hua, Y. , Kuhlman, B. , Raleigh, D.P.
Primary Citation of Related Structures: 1CQU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S RIBOSOMAL PROTEIN L9 | A | 56 | Geobacillus Stearothermophilus | MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQR |
Method: SOLUTION NMR
Deposited Date: 1999-08-11 Deposition Author(s): Hoffman, D. , Hua, Y. , Kuhlman, B. , Raleigh, D.P.