Conformational changes in cubic insulin crystals in the ph range 7-11
PDB DOI: 10.2210/pdb1cph/pdb
Classification: HORMONE Organism(s): Bos Taurus
Deposited: 1992-10-30 Deposition Author(s): Badger, J. , Caspar, D.L.D. , Gursky, O. , Li, Y.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Conformational changes in cubic insulin crystals in the ph range 7-11
Badger, J. , Caspar, D.L.D. , Gursky, O. , Li, Y.
Primary Citation of Related Structures: 1CPH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INSULIN (PH 10) | A | 21 | Bos Taurus | GIVEQCCASVCSLYQLENYCN |
| INSULIN (PH 10) | B | 30 | Bos Taurus | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Method: X-RAY DIFFRACTION
Deposited Date: 1992-10-30 Deposition Author(s): Badger, J. , Caspar, D.L.D. , Gursky, O. , Li, Y.