Structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
PDB DOI: 10.2210/pdb1chj/pdb
Classification: ELECTRON TRANSPORT(HEME PROTEIN) Organism(s): Saccharomyces Cerevisiae
Deposited: 1994-06-01 Deposition Author(s): Brayer, G.D. , Lo, T.P.
Structural studies of the roles of residues 82 and 85 at the interactive face of cytochrome c
Primary Citation of Related Structures: 1CHJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CYTOCHROME C | A | 108 | Saccharomyces Cerevisiae | TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGAKKEKDRNDLITYLKKATE |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-06-01 Deposition Author(s): Brayer, G.D. , Lo, T.P.