Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
PDB DOI: 10.2210/pdb1cf7/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1999-03-24 Deposition Author(s): Fraenkel, E. , Pabo, C.O. , Pavletich, N.P. , Zheng, N.
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
Fraenkel, E. , Pabo, C.O. , Pavletich, N.P. , Zheng, N.
Primary Citation of Related Structures: 1CF7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROTEIN (TRANSCRIPTION FACTOR E2F-4) | A | 76 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGP |
PROTEIN (TRANSCRIPTION FACTOR DP-2) | B | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQ |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-03-24 Deposition Author(s): Fraenkel, E. , Pabo, C.O. , Pavletich, N.P. , Zheng, N.