The structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4-aminomethylcyclohexane-1-carboxylic acid)
PDB DOI: 10.2210/pdb1ceb/pdb
Classification: SERINE PROTEASE Organism(s): Homo Sapiens
Deposited: 1995-12-03 Deposition Author(s): Mathews, I.I. , Tulinsky, A.
The structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4-aminomethylcyclohexane-1-carboxylic acid)
Primary Citation of Related Structures: 1CEB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PLASMINOGEN | A | 88 | Homo Sapiens | LSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMH |
| PLASMINOGEN | B | 88 | Homo Sapiens | LSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMH |
Method: X-RAY DIFFRACTION
Deposited Date: 1995-12-03 Deposition Author(s): Mathews, I.I. , Tulinsky, A.