Complex of the dna binding core domain of the transcription factor mef2a with a 20mer oligonucleotide
PDB DOI: 10.2210/pdb1c7u/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-03-17 Deposition Author(s): Clore, G.M. , Huang, K.
Method: SOLUTION NMR Resolution: N.A.
Complex of the dna binding core domain of the transcription factor mef2a with a 20mer oligonucleotide
Primary Citation of Related Structures: 1C7U
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM | A | 85 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVE |
MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM | B | 85 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVE |
Method: SOLUTION NMR
Deposited Date: 2000-03-17 Deposition Author(s): Clore, G.M. , Huang, K.