Sodium channel iia inactivation gate
PDB DOI: 10.2210/pdb1byy/pdb
Classification: MEMBRANE PROTEIN Organism(s): Rattus Norvegicus
Deposited: 1998-10-21 Deposition Author(s): Baker, C. , Boeckman, F.A. , Catterall, W.A. , Klevit, R.E. , Rohl, C.A. , Scheuer, T.
Sodium channel iia inactivation gate
Baker, C. , Boeckman, F.A. , Catterall, W.A. , Klevit, R.E. , Rohl, C.A. , Scheuer, T.
Primary Citation of Related Structures: 1BYY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (SODIUM CHANNEL ALPHA-SUBUNIT) | A | 53 | Rattus Norvegicus | DNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFD |
Method: SOLUTION NMR
Deposited Date: 1998-10-21 Deposition Author(s): Baker, C. , Boeckman, F.A. , Catterall, W.A. , Klevit, R.E. , Rohl, C.A. , Scheuer, T.