1BRV
Solution nmr structure of the immunodominant region of protein g of bovine respiratory syncytial virus, 48 structures
PDB DOI: 10.2210/pdb1brv/pdb
Classification: GLYCOPROTEIN Organism(s): Bovine Respiratory Syncytial Virus (Strain 391-2)
Deposited: 1996-03-29 Deposition Author(s): Boelens, R. , Doreleijers, J.F. , Hard, K. , Kaptein, R. , Langedijk, J.P.M. , Rullmann, J.A.C. , Schaaper, W.M. , Van Oirschot, J.T.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the immunodominant region of protein g of bovine respiratory syncytial virus, 48 structures
Boelens, R. , Doreleijers, J.F. , Hard, K. , Kaptein, R. , Langedijk, J.P.M. , Rullmann, J.A.C. , Schaaper, W.M. , Van Oirschot, J.T.
Primary Citation of Related Structures: 1BRV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN G | A | 32 | Bovine Respiratory Syncytial Virus (Strain 391-2) | NHQDHNNFQTLPYVPCSTCEGNLACLSLCHIE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 1996-03-29 Deposition Author(s): Boelens, R. , Doreleijers, J.F. , Hard, K. , Kaptein, R. , Langedijk, J.P.M. , Rullmann, J.A.C. , Schaaper, W.M. , Van Oirschot, J.T.