Three dimensional structure of the n-terminal domain of syntaxin 1a
PDB DOI: 10.2210/pdb1br0/pdb
Classification: MEMBRANE PROTEIN Organism(s): Rattus Norvegicus
Deposited: 1998-08-25 Deposition Author(s): Dubulova, I. , Fernandez, I. , Rizo, J. , Sudhof, T.C. , Ubach, J. , Zhang, X.
Method: SOLUTION NMR Resolution: N.A.
Three dimensional structure of the n-terminal domain of syntaxin 1a
Dubulova, I. , Fernandez, I. , Rizo, J. , Sudhof, T.C. , Ubach, J. , Zhang, X.
Primary Citation of Related Structures: 1BR0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (SYNTAXIN 1-A) | A | 120 | Rattus Norvegicus | DRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERSK |
Method: SOLUTION NMR
Deposited Date: 1998-08-25 Deposition Author(s): Dubulova, I. , Fernandez, I. , Rizo, J. , Sudhof, T.C. , Ubach, J. , Zhang, X.