A low energy structure for the final cytoplasmic loop of band 3, nmr, minimized average structure
PDB DOI: 10.2210/pdb1bh7/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 1998-06-16 Deposition Author(s): Askin, D. , Bloomberg, G.B. , Chambers, E.J. , Tanner, M.J.A.
Method: SOLUTION NMR Resolution: N.A.
A low energy structure for the final cytoplasmic loop of band 3, nmr, minimized average structure
Askin, D. , Bloomberg, G.B. , Chambers, E.J. , Tanner, M.J.A.
Primary Citation of Related Structures: 1BH7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BAND 3 | A | 33 | Homo Sapiens | IQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHL |
Method: SOLUTION NMR
Deposited Date: 1998-06-16 Deposition Author(s): Askin, D. , Bloomberg, G.B. , Chambers, E.J. , Tanner, M.J.A.