Advanced Search:
1B6J
Hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1
PDB DOI: 10.2210/pdb1b6j/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1999-01-17 Deposition Author(s): Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 1
Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.
Primary Citation of Related Structures: 1B6J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RETROPEPSIN | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| RETROPEPSIN | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| CYCLIC PEPTIDE INHIBITOR | C | 6 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NXPIVX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 1999-01-17 Deposition Author(s): Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.