T4 lysozyme mutant with cys 54 replaced by thr, cys 97 replaced by ala, thr 21 replaced by cys and lys 124 replaced by cys (c54t,c97a,t21c,k124c)
PDB DOI: 10.2210/pdb1b6i/pdb
Classification: HYDROLASE Organism(s): Enterobacteria Phage T4
Deposited: 1999-01-14 Deposition Author(s): Baase, W.A. , Matthews, B.W. , Snow, S. , Vetter, I.R.
T4 lysozyme mutant with cys 54 replaced by thr, cys 97 replaced by ala, thr 21 replaced by cys and lys 124 replaced by cys (c54t,c97a,t21c,k124c)
Baase, W.A. , Matthews, B.W. , Snow, S. , Vetter, I.R.
Primary Citation of Related Structures: 1B6I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (LYSOZYME) | A | 164 | Enterobacteria Phage T4 | MNIFEMLRIDEGLRLKIYKDCEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQCRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-01-14 Deposition Author(s): Baase, W.A. , Matthews, B.W. , Snow, S. , Vetter, I.R.