Solution structure of the spectrin repeat, nmr, 20 structures
PDB DOI: 10.2210/pdb1aj3/pdb
Classification: CYTOSKELETON Organism(s): Gallus Gallus
Deposited: 1997-05-14 Deposition Author(s): Nilges, M. , Pascual, J. , Pfuhl, M. , Saraste, M. , Walther, D.
Solution structure of the spectrin repeat, nmr, 20 structures
Nilges, M. , Pascual, J. , Pfuhl, M. , Saraste, M. , Walther, D.
Primary Citation of Related Structures: 1AJ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ALPHA SPECTRIN | A | 110 | Gallus Gallus | AKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLE |
Method: SOLUTION NMR
Deposited Date: 1997-05-14 Deposition Author(s): Nilges, M. , Pascual, J. , Pfuhl, M. , Saraste, M. , Walther, D.