Bcl11b zf2-3 in complex with a dna sequence containing two binding sites (motifs tgtccc and tggcct)
PDB DOI: 10.2210/pdb12uq/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2026-04-19 Deposition Author(s): Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.
Method: X-RAY DIFFRACTION Resolution: 3.29 Å
Bcl11b zf2-3 in complex with a dna sequence containing two binding sites (motifs tgtccc and tggcct)
Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.
Primary Citation of Related Structures: 12UQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| B-cell lymphoma/leukemia 11B | F | 66 | Homo Sapiens , Synthetic Construct | GPLGSPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGS |
| B-cell lymphoma/leukemia 11B | C | 66 | Homo Sapiens , Synthetic Construct | GPLGSPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGS |
Method: X-RAY DIFFRACTION
Deposited Date: 2026-04-19 Deposition Author(s): Cheng, X. , Horton, J.R. , Lee, J. , Zhou, J.